PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G45650.1
Common NameAGL6, F17K2.18, RSB1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MIKC_MADS
Protein Properties Length: 252aa    MW: 28744.5 Da    PI: 7.853
Description AGAMOUS-like 6
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G45650.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF100.18.5e-32958150
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                 krienk+nrqvtfskRrng+lKKA+ELSvLCdaeva+iifss+gklye+ 
  AT2G45650.1  9 KRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFG 58
                 79**********************************************95 PP

2K-box99.93.6e-3376171499
        K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                  s ++++ e++++s++qe++kLk+++e+L r++R+llGedL+++ +keLq Le+qLe +l+  R++K+++++e++e+l+kke++l ++nk+L+ k+e
  AT2G45650.1  76 SLSNNKPEETTQSWCQEVTKLKSKYESLVRTNRNLLGEDLGEMGVKELQALERQLEAALTATRQRKTQVMMEEMEDLRKKERQLGDINKQLKIKFE 171
                  4455678999**********************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.431161IPR002100Transcription factor, MADS-box
SMARTSM004327.4E-42160IPR002100Transcription factor, MADS-box
CDDcd002656.29E-45272No hitNo description
SuperFamilySSF554556.02E-34289IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-32323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003193.0E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-323859IPR002100Transcription factor, MADS-box
PfamPF014868.4E-3083170IPR002487Transcription factor, K-box
PROSITE profilePS5129715.27986176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009553Biological Processembryo sac development
GO:0009911Biological Processpositive regulation of flower development
GO:0010094Biological Processspecification of carpel identity
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010582Biological Processfloral meristem determinacy
GO:0030154Biological Processcell differentiation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048437Biological Processfloral organ development
GO:0048455Biological Processstamen formation
GO:0048459Biological Processfloral whorl structural organization
GO:0048509Biological Processregulation of meristem development
GO:0048833Biological Processspecification of floral organ number
GO:0080060Biological Processintegument development
GO:0080112Biological Processseed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0020003anatomyplant ovule
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MGRGRVEMKR IENKINRQVT FSKRRNGLLK KAYELSVLCD AEVALIIFSS RGKLYEFGSV  60
GIESTIERYN RCYNCSLSNN KPEETTQSWC QEVTKLKSKY ESLVRTNRNL LGEDLGEMGV  120
KELQALERQL EAALTATRQR KTQVMMEEME DLRKKERQLG DINKQLKIKF ETEGHAFKTF  180
QDLWANSAAS VAGDPNNSEF PVEPSHPNVL DCNTEPFLQI GFQQHYYVQG EGSSVSKSNV  240
AGETNFVQGW VL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D3e-20269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C3e-20269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B3e-20269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A3e-20269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_S4e-20170170Myocyte-specific enhancer factor 2B
1tqe_R4e-20170170Myocyte-specific enhancer factor 2B
1tqe_Q4e-20170170Myocyte-specific enhancer factor 2B
1tqe_P4e-20170170Myocyte-specific enhancer factor 2B
3p57_J4e-20269168Myocyte-specific enhancer factor 2A
3p57_I4e-20269168Myocyte-specific enhancer factor 2A
3p57_D4e-20269168Myocyte-specific enhancer factor 2A
3p57_C4e-20269168Myocyte-specific enhancer factor 2A
3p57_B4e-20269168Myocyte-specific enhancer factor 2A
3p57_A4e-20269168Myocyte-specific enhancer factor 2A
3kov_J4e-20269168Myocyte-specific enhancer factor 2A
3kov_I4e-20269168Myocyte-specific enhancer factor 2A
3kov_B4e-20269168Myocyte-specific enhancer factor 2A
3kov_A4e-20269168Myocyte-specific enhancer factor 2A
4ox0_D5e-208817019101Developmental protein SEPALLATA 3
4ox0_C5e-208817019101Developmental protein SEPALLATA 3
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.5120.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO10199240.0
Genevisible267528_at0.0
Expression AtlasAT2G45650-
AtGenExpressAT2G45650-
ATTED-IIAT2G45650-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Preferentially expressed in flowers.
Functional Description ? help Back to Top
Source Description
TAIRsequence suggests this encodes a MADS-box transcription factor
UniProtProbable transcription factor. Forms a heterodimer via the K-box domain with AG, that could be involved in genes regulation during floral meristem development.
Function -- GeneRIF ? help Back to Top
  1. AGL6 and AGL13 are regulated through complex interactions of enhancer and silencer elements located in both the 5'-upstream regions and the large first introns.
    [PMID: 19473325]
  2. Early flowering and developmental defects are caused by overexpression of AGL6.
    [PMID: 20230491]
  3. Results suggest that AGL6 acts as a floral promoter with a dual role, the inhibition of the transcription of the FLC/MAF genes and the promotion of FT expression in Arabidopsis.
    [PMID: 21175890]
  4. agamous-like 6 plays a potential role in the regulation of the circadian clock by regulating zeitlupe mRNA level in Arabidopsis
    [PMID: 21331777]
  5. a function of AGAMOUS-LIKE6 in axillary bud formation in Arabidopsis
    [PMID: 22730404]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00315DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G45650.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction -- BIND ? help Back to Top
Source Intact With Description
BINDAT4G18960AG interacts with AGL6.
Interaction ? help Back to Top
Source Intact With
BioGRIDAT2G45660, AT3G57230, AT4G18960, AT4G24540, AT4G37940, AT5G13790, AT5G15800, AT5G27070, AT5G27130, AT5G60910, AT5G62165, AT5G65330, AT1G24260, AT1G31630, AT1G31640, AT1G46408, AT1G48150, AT1G69120, AT1G77980
IntActSearch P29386
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G45650
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankATHAGL6A0.0M55554.1 Arabidopsis thaliana transcription factor (AGL6) mRNA, complete cds.
GenBankDQ4466240.0DQ446624.1 Arabidopsis thaliana clone pENTR221-At2g45650 MADS-box protein (At2g45650) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_182089.10.0agamous-like MADS-box protein AGL6
SwissprotP293860.0AGL6_ARATH; Agamous-like MADS-box protein AGL6
TrEMBLQ1PEU30.0Q1PEU3_ARATH; AGAMOUS-like protein 6
STRINGAT2G45650.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM43022654
Representative plantOGRP1617761
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  3. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  4. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  5. Ma H,Yanofsky MF,Meyerowitz EM
    AGL1-AGL6, an Arabidopsis gene family with similarity to floral homeotic and transcription factor genes.
    Genes Dev., 1991. 5(3): p. 484-95
    [PMID:1672119]
  6. Fan J,Li W,Dong X,Guo W,Shu H
    Ectopic expression of a hyacinth AGL6 homolog caused earlier flowering and homeotic conversion in Arabidopsis.
    Sci. China, C, Life Sci., 2007. 50(5): p. 676-89
    [PMID:17879068]
  7. Schauer SE, et al.
    Intronic regulatory elements determine the divergent expression patterns of AGAMOUS-LIKE6 subfamily members in Arabidopsis.
    Plant J., 2009. 59(6): p. 987-1000
    [PMID:19473325]
  8. Koo SC, et al.
    Control of lateral organ development and flowering time by the Arabidopsis thaliana MADS-box Gene AGAMOUS-LIKE6.
    Plant J., 2010. 62(5): p. 807-16
    [PMID:20230491]
  9. Yoo SK,Wu X,Lee JS,Ahn JH
    AGAMOUS-LIKE 6 is a floral promoter that negatively regulates the FLC/MAF clade genes and positively regulates FT in Arabidopsis.
    Plant J., 2011. 65(1): p. 62-76
    [PMID:21175890]
  10. Yoo SK,Hong SM,Lee JS,Ahn JH
    A genetic screen for leaf movement mutants identifies a potential role for AGAMOUS-LIKE 6 (AGL6) in circadian-clock control.
    Mol. Cells, 2011. 31(3): p. 281-7
    [PMID:21331777]
  11. Huang X,Effgen S,Meyer RC,Theres K,Koornneef M
    Epistatic natural allelic variation reveals a function of AGAMOUS-LIKE6 in axillary bud formation in Arabidopsis.
    Plant Cell, 2012. 24(6): p. 2364-79
    [PMID:22730404]
  12. Meinke DW
    A survey of dominant mutations in Arabidopsis thaliana.
    Trends Plant Sci., 2013. 18(2): p. 84-91
    [PMID:22995285]
  13. Tandre K,Albert VA,Sund
    Conifer homologues to genes that control floral development in angiosperms.
    Plant Mol. Biol., 1995. 27(1): p. 69-78
    [PMID:7865797]
  14. Fan HY,Hu Y,Tudor M,Ma H
    Specific interactions between the K domains of AG and AGLs, members of the MADS domain family of DNA binding proteins.
    Plant J., 1997. 12(5): p. 999-1010
    [PMID:9418042]
  15. Mouradov A, et al.
    Family of MADS-Box genes expressed early in male and female reproductive structures of monterey pine
    Plant Physiol., 1998. 117(1): p. 55-62
    [PMID:9576774]